Reaction Details |
| Report a problem with these data |
Target | Leukotriene C4 synthase |
---|
Ligand | BDBM50519585 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1876789 (CHEMBL4378183) |
---|
IC50 | 0.381000±n/a nM |
---|
Citation | Munck Af Rosenschöld, M; Johannesson, P; Nikitidis, A; Tyrchan, C; Chang, HF; Rönn, R; Chapman, D; Ullah, V; Nikitidis, G; Glader, P; Käck, H; Bonn, B; Wågberg, F; Björkstrand, E; Andersson, U; Swedin, L; Rohman, M; Andreasson, T; Bergström, EL; Jiang, F; Zhou, XH; Lundqvist, AJ; Malmberg, A; Ek, M; Gordon, E; Pettersen, A; Ripa, L; Davis, AM Discovery of the Oral Leukotriene C4 Synthase Inhibitor (1 J Med Chem62:7769-7787 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Leukotriene C4 synthase |
---|
Name: | Leukotriene C4 synthase |
Synonyms: | LTC4 synthase | LTC4S | LTC4S_HUMAN | Leukotriene-C(4) synthase |
Type: | PROTEIN |
Mol. Mass.: | 16575.59 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_961179 |
Residue: | 150 |
Sequence: | MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
|
|
|
BDBM50519585 |
---|
n/a |
---|
Name | BDBM50519585 |
Synonyms: | CHEMBL4464773 |
Type | Small organic molecule |
Emp. Form. | C25H25FN2O4 |
Mol. Mass. | 436.4754 |
SMILES | COc1cc(cnc1C(=O)[C@H]1C[C@@H]1C(O)=O)N(CC(C)C)c1ccc(F)c2ccccc12 |r| |
Structure |
|