| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orexin receptor type 2 |
|---|
| Ligand | BDBM334973 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1879203 (CHEMBL4380597) |
|---|
| Ki | 1.3±n/a nM |
|---|
| Citation |  Rappas, M; Ali, AAE; Bennett, KA; Brown, JD; Bucknell, SJ; Congreve, M; Cooke, RM; Cseke, G; de Graaf, C; Doré, AS; Errey, JC; Jazayeri, A; Marshall, FH; Mason, JS; Mould, R; Patel, JC; Tehan, BG; Weir, M; Christopher, JA Comparison of Orexin 1 and Orexin 2 Ligand Binding Modes Using X-ray Crystallography and Computational Analysis. J Med Chem63:1528-1543 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Orexin receptor type 2 |
|---|
| Name: | Orexin receptor type 2 |
|---|
| Synonyms: | HCRTR2 | Hypocretin receptor type 2 | OX2R_HUMAN | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 50710.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O43614 |
|---|
| Residue: | 444 |
|---|
| Sequence: | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
|
|
|
|---|
| BDBM334973 |
|---|
| n/a |
|---|
| Name | BDBM334973 |
|---|
| Synonyms: | US11040966, Example 5.36 | US9732075, Example 5.36 | US9914721, Ex. 7 | [(S)-2-(5-Chloro-4-methyl-1H-benzoimidazol-2-yl)-2-methyl-pyrrolidin-1-yl]-(5-methoxy-2-[1,2,3]triazol-2-yl-phenyl)-methanone |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23ClN6O2 |
|---|
| Mol. Mass. | 450.921 |
|---|
| SMILES | COc1ccc(c(c1)C(=O)N1CCC[C@@]1(C)c1nc2c(C)c(Cl)ccc2[nH]1)-n1nccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
