Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM50005835 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1701 (CHEMBL616908) |
---|
IC50 | 6.7±n/a nM |
---|
Citation | Sternfeld, F; Guiblin, AR; Jelley, RA; Matassa, VG; Reeve, AJ; Hunt, PA; Beer, MS; Heald, A; Stanton, JA; Sohal, B; Watt, AP; Street, LJ Synthesis and serotonergic activity of 3-[2-(pyrrolidin-1-yl)ethyl]indoles: potent agonists for the h5-HT1D receptor with high selectivity over the h5-HT1B receptor. J Med Chem42:677-90 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41920.63 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
Residue: | 377 |
Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
BDBM50005835 |
---|
n/a |
---|
Name | BDBM50005835 |
Synonyms: | (3-[2-(dimethylamino)ethyl]-1H-indol-5-yl)-N-methylmethanesulfonamide | 1-[3-(2-dimethylaminoethyl)-1H-indol-5-yl]-N-methyl-methanesulfonamide | 1-{3-[2-(dimethylamino)ethyl]-1H-indol-5-yl}-N-methylmethanesulfonamide | 3-(2-(dimethylamino)ethyl)-N-methyl-1H-indole-5-methanesulfonamide | 3-[2-(dimethylamino)ethyl]-N-methylindole-5-methanesulfonamide | CHEMBL128 | SUMATRIPTAN | Sumatran | Sumax |
Type | Small organic molecule |
Emp. Form. | C14H21N3O2S |
Mol. Mass. | 295.4 |
SMILES | CNS(=O)(=O)Cc1ccc2[nH]cc(CCN(C)C)c2c1 |
Structure |
|