Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor 1
LigandBDBM50074401
Substrate/Competitorn/a
Meas. Tech.ChEMBL_51111
Ki 5±n/a nM
Citation Arvanitis AGGilligan PJChorvat RJCheeseman RSChristos TEBakthavatchalam RBeck JPCocuzza AJHobbs FWWilde RGArnold CChidester DCurry MHe LHollis AKlaczkiewicz JKrenitsky PJRescinito JPScholfield ECulp SDe Souza EBFitzgerald LGrigoriadis DTam SWShen HL Non-peptide corticotropin-releasing hormone antagonists: syntheses and structure-activity relationships of 2-anilinopyrimidines and -triazines. J Med Chem 42:805-18 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor 1
Name:Corticotropin releasing factor receptor 1
Synonyms:CRF-R | CRF-R2 Alpha | CRF1 | CRH-R 1 | CRHR1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1
Type:Enzyme
Mol. Mass.:50744.31
Organism:Homo sapiens (Human)
Description:P34998
Residue:444
Sequence:
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074401
n/a
NameBDBM50074401
Synonyms:CHEMBL166345 | N-Allyl-N'-(2-bromo-4-isopropyl-phenyl)-N-cyclopropyl-N'-ethyl-6-methyl-[1,3,5]triazine-2,4-diamine
TypeSmall organic molecule
Emp. Form.C21H28BrN5
Mol. Mass.430.385
SMILESCCN(c1nc(C)nc(n1)N(CC=C)C1CC1)c1ccc(cc1Br)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: