Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 1
LigandBDBM50075802
Substrate/Competitorn/a
Meas. Tech.ChEBML_143824
Ki 0.313000±n/a nM
Citation Zarrinmayeh HZimmerman DMCantrell BESchober DABruns RFGackenheimer SLOrnstein PLHipskind PABritton TCGehlert DR Structure-activity relationship of a series of diaminoalkyl substituted benzimidazole as neuropeptide Y Y1 receptor antagonists. Bioorg Med Chem Lett 9:647-52 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 1
Name:Neuropeptide Y receptor type 1
Synonyms:NPY-Y1 | NPY1-R | neuropeptide Y receptor Y1
Type:Enzyme Catalytic Domain
Mol. Mass.:44399.07
Organism:Homo sapiens (Human)
Description:NPY-Y1 NPY1R HUMAN::P25929
Residue:384
Sequence:
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075802
n/a
NameBDBM50075802
Synonyms:4-[2-(4-{3-[2-Phenoxymethyl-4-(3-piperidin-1-yl-propoxy)-benzoimidazol-1-yl]-propyl}-piperidin-1-yl)-ethyl]-phenol | CHEMBL350917
TypeSmall organic molecule
Emp. Form.C38H50N4O3
Mol. Mass.610.8286
SMILESOc1ccc(CCN2CCC(CCCn3c(COc4ccccc4)nc4c(OCCCN5CCCCC5)cccc34)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: