Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50079704 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_79953 (CHEMBL687724) |
---|
pH | 6.2±n/a |
---|
IC50 | 17±n/a nM |
---|
Comments | extracted |
---|
Citation | Ellsworth, EL; Domagala, J; Prasad, JV; Hagen, S; Ferguson, D; Holler, T; Hupe, D; Graham, N; Nouhan, C; Tummino, PJ; Zeikus, G; Lunney, EA 4-hydroxy-5,6-dihydro-2H-pyran-2-ones.3. Bicyclic and hetero-aromatic ring systems as 3-position scaffolds to bind to S1' and S2' of the HIV-1 protease enzyme. Bioorg Med Chem Lett9:2019-24 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50079704 |
---|
n/a |
---|
Name | BDBM50079704 |
Synonyms: | 3-(3-tert-Butyl-benzo[b]thiophen-2-ylsulfanyl)-4-hydroxy-6-phenethyl-6-phenyl-5,6-dihydro-pyran-2-one | CHEMBL59522 |
Type | Small organic molecule |
Emp. Form. | C31H30O3S2 |
Mol. Mass. | 514.698 |
SMILES | CC(C)(C)c1c(SC2C(=O)CC(CCc3ccccc3)(OC2=O)c2ccccc2)sc2ccccc12 |
Structure |
|