| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM50079939 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1394 (CHEMBL832874) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Birch, AM; Bradley, PA; Gill, JC; Kerrigan, F; Needham, PL N-Substituted (2,3-dihydro-1,4-benzodioxin-2-yl)methylamine derivatives as D(2) antagonists/5-HT(1A) partial agonists with potential as atypical antipsychotic agents. J Med Chem42:3342-55 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5HT1B_PIG | HTR1B | Serotonin 1b (5-HT1b) receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16950.74 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_1394 |
|---|
| Residue: | 150 |
|---|
| Sequence: | VEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRAPDLPSESGSPVYVNQVKV
RVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLAMPICKDACWFHLAIFD
FFTWLGYLNSLINPIIYTMFNEDFKQAFHK
|
|
|
|---|
| BDBM50079939 |
|---|
| n/a |
|---|
| Name | BDBM50079939 |
|---|
| Synonyms: | (7-Chloro-2,3-dihydro-benzo[1,4]dioxin-2-ylmethyl)-[1-(2-methoxy-phenyl)-piperidin-4-ylmethyl]-amine | CHEMBL418854 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27ClN2O3 |
|---|
| Mol. Mass. | 402.914 |
|---|
| SMILES | COc1ccccc1N1CCC(CNCC2COc3ccc(Cl)cc3O2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
