Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor alpha
LigandBDBM50079939
Substrate/Competitorn/a
Meas. Tech.ChEMBL_33681
Ki>500±n/a nM
Citation Birch AMBradley PAGill JCKerrigan FNeedham PL N-Substituted (2,3-dihydro-1,4-benzodioxin-2-yl)methylamine derivatives as D(2) antagonists/5-HT(1A) partial agonists with potential as atypical antipsychotic agents. J Med Chem 42:3342-55 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor alpha
Name:Adrenergic receptor alpha
Synonyms:Adrenaline 2 | Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha2 Adrenoreceptor | CA2-47 | adrenergic Alpha2A
Type:G-protein coupled receptor
Mol. Mass.:48961.69
Organism:Rattus norvegicus (rat)
Description:Partially purified membrane from rat cortex was used in assays.
Residue:450
Sequence:
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG
QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS
APPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSE
HAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079939
n/a
NameBDBM50079939
Synonyms:(7-Chloro-2,3-dihydro-benzo[1,4]dioxin-2-ylmethyl)-[1-(2-methoxy-phenyl)-piperidin-4-ylmethyl]-amine | CHEMBL418854
TypeSmall organic molecule
Emp. Form.C22H27ClN2O3
Mol. Mass.402.914
SMILESCOc1ccccc1N1CCC(CNCC2COc3ccc(Cl)cc3O2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: