| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM50080528 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_66274 (CHEMBL678144) |
|---|
| Ki | 3400±n/a nM |
|---|
| Citation |  Christner, C; Wyrwa, R; Marsch, S; Küllertz, G; Thiericke, R; Grabley, S; Schumann, D; Fischer, G Synthesis and cytotoxic evaluation of cycloheximide derivatives as potential inhibitors of FKBP12 with neuroregenerative properties. J Med Chem42:3615-22 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11953.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62942 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
|---|
| BDBM50080528 |
|---|
| n/a |
|---|
| Name | BDBM50080528 |
|---|
| Synonyms: | 3-((R)-2-((1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl)-2-hydroxyethyl)glutarimide | 4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}piperidine-2,6-dione | CHEMBL123292 | Cycloheximid | Zykloheximid | cid_6197 | cycloheximide | med.21724, Compound Cycloheximide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H23NO4 |
|---|
| Mol. Mass. | 281.3474 |
|---|
| SMILES | C[C@H]1C[C@H](C)C(=O)[C@@H](C1)[C@H](O)CC1CC(=O)NC(=O)C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
