Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP14 |
---|
Ligand | BDBM50080528 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_66427 (CHEMBL682335) |
---|
Ki | 76200.0±n/a nM |
---|
Citation | Christner, C; Wyrwa, R; Marsch, S; Küllertz, G; Thiericke, R; Grabley, S; Schumann, D; Fischer, G Synthesis and cytotoxic evaluation of cycloheximide derivatives as potential inhibitors of FKBP12 with neuroregenerative properties. J Med Chem42:3615-22 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP14 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP14 |
Synonyms: | FK506 binding protein 14 | FKB14_HUMAN | FKBP14 | FKBP22 |
Type: | PROTEIN |
Mol. Mass.: | 24168.38 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_66427 |
Residue: | 211 |
Sequence: | MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYKHDEL
|
|
|
BDBM50080528 |
---|
n/a |
---|
Name | BDBM50080528 |
Synonyms: | 3-((R)-2-((1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl)-2-hydroxyethyl)glutarimide | 4-{(2R)-2-[(1S,3S,5S)-3,5-dimethyl-2-oxocyclohexyl]-2-hydroxyethyl}piperidine-2,6-dione | CHEMBL123292 | Cycloheximid | Zykloheximid | cid_6197 | cycloheximide | med.21724, Compound Cycloheximide |
Type | Small organic molecule |
Emp. Form. | C15H23NO4 |
Mol. Mass. | 281.3474 |
SMILES | C[C@H]1C[C@H](C)C(=O)[C@@H](C1)[C@H](O)CC1CC(=O)NC(=O)C1 |r| |
Structure |
|