Reaction Details |
| Report a problem with these data |
Target | rRNA adenine N-6-methyltransferase |
---|
Ligand | BDBM50081277 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_67535 (CHEMBL679972) |
---|
Ki | >50000±n/a nM |
---|
Citation | Hajduk, PJ; Dinges, J; Schkeryantz, JM; Janowick, D; Kaminski, M; Tufano, M; Augeri, DJ; Petros, A; Nienaber, V; Zhong, P; Hammond, R; Coen, M; Beutel, B; Katz, L; Fesik, SW Novel inhibitors of Erm methyltransferases from NMR and parallel synthesis. J Med Chem42:3852-9 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
rRNA adenine N-6-methyltransferase |
---|
Name: | rRNA adenine N-6-methyltransferase |
Synonyms: | ERM_BACIU | Erythromycin resistance protein |
Type: | PROTEIN |
Mol. Mass.: | 28925.75 |
Organism: | Bacillus subtilis |
Description: | ChEMBL_67535 |
Residue: | 244 |
Sequence: | MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIRKIVFDSIA
DEIYLIVEYGFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK
SRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYK
LFNK
|
|
|
BDBM50081277 |
---|
n/a |
---|
Name | BDBM50081277 |
Synonyms: | 6-(4-Amino-phenyl)-N-indan-2-yl-[1,3,5]triazine-2,4-diamine | CHEMBL126964 |
Type | Small organic molecule |
Emp. Form. | C18H18N6 |
Mol. Mass. | 318.3757 |
SMILES | Nc1ccc(cc1)-c1nc(N)nc(NC2Cc3ccccc3C2)n1 |
Structure |
|