| Reaction Details |
|---|
 | Report a problem with these data |
| Target | rRNA adenine N-6-methyltransferase |
|---|
| Ligand | BDBM50081290 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_67535 (CHEMBL679972) |
|---|
| Ki | >100000±n/a nM |
|---|
| Citation |  Hajduk, PJ; Dinges, J; Schkeryantz, JM; Janowick, D; Kaminski, M; Tufano, M; Augeri, DJ; Petros, A; Nienaber, V; Zhong, P; Hammond, R; Coen, M; Beutel, B; Katz, L; Fesik, SW Novel inhibitors of Erm methyltransferases from NMR and parallel synthesis. J Med Chem42:3852-9 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| rRNA adenine N-6-methyltransferase |
|---|
| Name: | rRNA adenine N-6-methyltransferase |
|---|
| Synonyms: | ERM_BACIU | Erythromycin resistance protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28925.75 |
|---|
| Organism: | Bacillus subtilis |
|---|
| Description: | ChEMBL_67535 |
|---|
| Residue: | 244 |
|---|
| Sequence: | MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIRKIVFDSIA
DEIYLIVEYGFAKRLLNTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK
SRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYK
LFNK
|
|
|
|---|
| BDBM50081290 |
|---|
| n/a |
|---|
| Name | BDBM50081290 |
|---|
| Synonyms: | 4-(Indan-2-ylamino)-6-piperidin-1-yl-[1,3,5]triazin-2-ol | CHEMBL331635 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H21N5O |
|---|
| Mol. Mass. | 311.3815 |
|---|
| SMILES | O=c1nc(nc(NC2Cc3ccccc3C2)[nH]1)N1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
