Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP2 subtype |
---|
Ligand | BDBM50081439 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158303 |
---|
Ki | 23000±n/a nM |
---|
Citation | Ruel, R; Lacombe, P; Abramovitz, M; Godbout, C; Lamontagne, S; Rochette, C; Sawyer, N; Stocco, R; Tremblay, NM; Metters, KM; Labelle, M New class of biphenylene dibenzazocinones as potent ligands for the human EP1 prostanoid receptor. Bioorg Med Chem Lett9:2699-704 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP2 subtype |
---|
Name: | Prostaglandin E2 receptor EP2 subtype |
Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
Type: | Enzyme |
Mol. Mass.: | 39775.71 |
Organism: | Homo sapiens (Human) |
Description: | P43116 |
Residue: | 358 |
Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
BDBM50081439 |
---|
n/a |
---|
Name | BDBM50081439 |
Synonyms: | CHEMBL92539 | sulfonylurea analogue |
Type | Small organic molecule |
Emp. Form. | C38H35N3O4S |
Mol. Mass. | 629.767 |
SMILES | CN(CCc1ccccc1)C(=O)NS(=O)(=O)c1ccccc1-c1ccc(CN2c3ccccc3CCc3ccccc3C2=O)cc1 |
Structure |
|