Reaction Details |
| Report a problem with these data |
Target | Proteinase-activated receptor 4 |
---|
Ligand | BDBM50528295 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1904774 (CHEMBL4407132) |
---|
IC50 | >3000±n/a nM |
---|
Citation | Miller, MM; Banville, J; Friends, TJ; Gagnon, M; Hangeland, JJ; Lavallée, JF; Martel, A; O'Grady, H; Rémillard, R; Ruediger, E; Tremblay, F; Posy, SL; Allegretto, NJ; Guarino, VR; Harden, DG; Harper, TW; Hartl, K; Josephs, J; Malmstrom, S; Watson, C; Yang, Y; Zhang, G; Wong, P; Yang, J; Bouvier, M; Seiffert, DA; Wexler, RR; Lawrence, RM; Priestley, ES; Marinier, A Discovery of Potent Protease-Activated Receptor 4 Antagonists with in Vivo Antithrombotic Efficacy. J Med Chem62:7400-7416 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteinase-activated receptor 4 |
---|
Name: | Proteinase-activated receptor 4 |
Synonyms: | Coagulation factor II receptor-like 3 | F2RL3 | PAR-4 | PAR4 | PAR4_HUMAN | Proteinase-activated receptor 4 | Proteinase-activated receptor 4 (PAR4) | Thrombin receptor-like 3 |
Type: | Protein |
Mol. Mass.: | 41145.16 |
Organism: | Homo sapiens (Human) |
Description: | Q96RI0 |
Residue: | 385 |
Sequence: | MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDT
LELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAA
ADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVH
PLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVLCHDALPLDAQASH
WQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSP
GDTVASKASAEGGSRGMGTHSSLLQ
|
|
|
BDBM50528295 |
---|
n/a |
---|
Name | BDBM50528295 |
Synonyms: | CHEMBL4539616 |
Type | Small organic molecule |
Emp. Form. | C22H19N3O5S |
Mol. Mass. | 437.468 |
SMILES | COc1nn2cc(nc2s1)-c1cc2c(OCc3ccc(OC)cc3)cc(OC)cc2o1 |
Structure |
|