| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50084227 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_86536 (CHEMBL699955) |
|---|
| Kd | 620±n/a nM |
|---|
| Citation |  Gütschow, M; Kuerschner, L; Neumann, U; Pietsch, M; Löser, R; Koglin, N; Eger, K 2-(diethylamino)thieno1,3??xazin-4-ones as stable inhibitors of human leukocyte elastase. J Med Chem42:5437-47 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50084227 |
|---|
| n/a |
|---|
| Name | BDBM50084227 |
|---|
| Synonyms: | 2-(diethylamino)-5-methyl-4-oxo-4H-thieno[2,3-d][1,3]oxazine-6-carboxamide | 2-Diethylamino-5-methyl-4-oxo-4H-thieno[2,3-d][1,3]oxazine-6-carboxylic acid amide | CHEMBL153784 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H15N3O3S |
|---|
| Mol. Mass. | 281.331 |
|---|
| SMILES | CCN(CC)c1nc2sc(C(N)=O)c(C)c2c(=O)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
