| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsin-like elastase family member 2A |
|---|
| Ligand | BDBM50085363 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_152309 |
|---|
| IC50 | 48000±n/a nM |
|---|
| Citation |  Hayashi, Y; Iijima, K; Katada, J; Kiso, Y Structure-activity relationship studies of chloromethyl ketone derivatives for selective human chymase inhibitors. Bioorg Med Chem Lett10:199-201 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsin-like elastase family member 2A |
|---|
| Name: | Chymotrypsin-like elastase family member 2A |
|---|
| Synonyms: | CEL2A_PIG | CELA2A | ELA2 | ELA2A | Elastase 2A | Elastase-2 | Elastase-2A | Pancreatic elastase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28705.23 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_156951 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
|
|
|
|---|
| BDBM50085363 |
|---|
| n/a |
|---|
| Name | BDBM50085363 |
|---|
| Synonyms: | CHEMBL60718 | L-1-Tosylamido-2-phenylethyl chloromethyl ketone | N-Tosyl-L-phenylalanine chloromethyl ketone | N-Tosyl-L-phenylalanyl chloromethyl ketone | N-[(2S)-4-chloro-3-oxo-1-phenylbutan-2-yl]-4-methylbenzenesulfonamide | TPCK | Tos-Phe-CH2Cl | Tosylphenylalanyl chloromethyl ketone | cid_439647 | l-N-(alpha-(Chloroacetyl)phenethyl)-p-toluenesulfonamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H18ClNO3S |
|---|
| Mol. Mass. | 351.848 |
|---|
| SMILES | Cc1ccc(cc1)S(=O)(=O)N[C@@H](Cc1ccccc1)C(=O)CCl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
