| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50085366 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_215994 |
|---|
| IC50 | 2200±n/a nM |
|---|
| Citation |  Hayashi, Y; Iijima, K; Katada, J; Kiso, Y Structure-activity relationship studies of chloromethyl ketone derivatives for selective human chymase inhibitors. Bioorg Med Chem Lett10:199-201 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50085366 |
|---|
| n/a |
|---|
| Name | BDBM50085366 |
|---|
| Synonyms: | CHEMBL292834 | N-((S)-1-Benzyl-3-chloro-2-oxo-propyl)-3-(4-methoxy-phenyl)-propionamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22ClNO3 |
|---|
| Mol. Mass. | 359.847 |
|---|
| SMILES | COc1ccc(CCC(=O)N[C@@H](Cc2ccccc2)C(=O)CCl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
