Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeutral Endopeptidase (NEP)
LigandBDBM50085452
Substrate/Competitorn/a
Meas. Tech.ChEBML_144612
IC50 20±n/a nM
Citation Robl JASimpkins LMAsaad MM N-formyl hydroxylamine containing dipeptides: generation of a new class of vasopeptidase inhibitors. Bioorg Med Chem Lett 10:257-60 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Neutral Endopeptidase (NEP)
Name:Neprilysin
Synonyms:Neutral endopeptidase 24.11
Type:Protein
Mol. Mass.:85789.59
Organism:Rattus norvegicus (Rat)
Description:P07861
Residue:750
Sequence:
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASAEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLTLLPDIYGWPVASQNWEQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQRLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEINGKPFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYKEEEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSARQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFTWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085452
n/a
NameBDBM50085452
Synonyms:(S)-2-[((S)-6-Amino-2-methanesulfonylamino-hexanoylamino)-methyl]-3-{1-[(S)-1-carboxy-2-(4-hydroxy-phenyl)-ethylcarbamoyl]-cyclopentyl}-propionic acid | CHEMBL42583 | Sampatrilat
TypeSmall organic molecule
Emp. Form.C26H40N4O9S
Mol. Mass.584.682
SMILESCS(=O)(=O)N[C@@H](CCCCN)C(=O)NC[C@H](CC1(CCCC1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: