Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin-releasing hormone receptor
LigandBDBM50085735
Substrate/Competitorn/a
Meas. Tech.ChEMBL_71750
Ki 0.28±n/a nM
Citation Rivier JEStruthers RSPorter JLahrichi SLJiang GCervini LAIbea MKirby DAKoerber SCRivier CL Design of potent dicyclic (4-10/5-8) gonadotropin releasing hormone (GnRH) antagonists. J Med Chem 43:784-96 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin-releasing hormone receptor
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R
Type:PROTEIN
Mol. Mass.:37767.60
Organism:Rattus norvegicus
Description:ChEMBL_1335047
Residue:327
Sequence:
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFGTSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085735
n/a
NameBDBM50085735
Synonyms:CHEMBL412681 | Cyclo (5-8) [Ac-D Nal, D Cpa, D Pal, Asp, Glu, D Arg, Leu, Aph, Pro, D Ala]GnRH
TypeSmall organic molecule
Emp. Form.C61H83ClN16O14
Mol. Mass.1299.864
SMILESCC[C@H](NC(C)=O)C(=O)N[C@@H](Cc1ccc(Cl)cc1)C(=O)N[C@@H](Cc1cccnc1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]1CCC(=O)Nc2ccc(C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CCCNC(N)=N)NC1=O)C(=O)N1CCC[C@@H]1C(=O)N[C@@H](C)C(N)=O)cc2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: