| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50277889 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1921004 (CHEMBL4423849) |
|---|
| IC50 | 8.6±n/a nM |
|---|
| Citation |  Dong, XW; Zhang, JK; Xu, L; Che, JX; Cheng, G; Hu, XB; Sheng, L; Gao, AH; Li, J; Liu, T; Hu, YZ; Zhou, YB Covalent docking modelling-based discovery of tripeptidyl epoxyketone proteasome inhibitors composed of aliphatic-heterocycles. Eur J Med Chem164:602-614 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50277889 |
|---|
| n/a |
|---|
| Name | BDBM50277889 |
|---|
| Synonyms: | CARFILZOMIB | CHEMBL451887 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H57N5O7 |
|---|
| Mol. Mass. | 719.9099 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](CCc1ccccc1)NC(=O)CN1CCOCC1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)[C@@]1(C)CO1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
