| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-7 |
|---|
| Ligand | BDBM113069 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1921341 (CHEMBL4424186) |
|---|
| IC50 | 48±n/a nM |
|---|
| Citation |  White, GV; Edgar, EV; Holmes, DS; Lewell, XQ; Liddle, J; Polyakova, O; Smith, KJ; Thorpe, JH; Walker, AL; Wang, Y; Young, RJ; Hovnanian, A Kallikrein 5 inhibitors identified through structure based drug design in search for a treatment for Netherton Syndrome. Bioorg Med Chem Lett29:821-825 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-7 |
|---|
| Name: | Kallikrein-7 |
|---|
| Synonyms: | KLK7 | KLK7_HUMAN | Kallikrein 7 | Kallikrein-7 | PRSS6 | SCCE | Serine protease 6 | Stratum corneum chymotryptic enzyme | hK7 | hSCCE | kallikrein-7 isoform 1 preproprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27535.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469257 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR
|
|
|
|---|
| BDBM113069 |
|---|
| n/a |
|---|
| Name | BDBM113069 |
|---|
| Synonyms: | US9695194, 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H17NO5 |
|---|
| Mol. Mass. | 327.3313 |
|---|
| SMILES | CCOc1cc2c(cc1OC)nc(oc2=O)-c1ccccc1OC |
|---|
| Structure | 
|
|---|
Search and Browse
