| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50532691 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1923562 (CHEMBL4426518) |
|---|
| Ki | 3600±n/a nM |
|---|
| Citation |  Junker, A; Balasubramanian, R; Ciancetta, A; Uliassi, E; Kiselev, E; Martiriggiano, C; Trujillo, K; Mtchedlidze, G; Birdwell, L; Brown, KA; Harden, TK; Jacobson, KA Structure-Based Design of 3-(4-Aryl-1H-1,2,3-triazol-1-yl)-Biphenyl Derivatives as P2Y14 Receptor Antagonists. J Med Chem59:6149-68 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50532691 |
|---|
| n/a |
|---|
| Name | BDBM50532691 |
|---|
| Synonyms: | CHEMBL4455037 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H22F3NO2 |
|---|
| Mol. Mass. | 449.4643 |
|---|
| SMILES | OC(=O)c1cc(cc(c1)-c1ccc(cc1)C1CCNCC1)C#Cc1ccc(cc1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
