Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50089096 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_49942 |
---|
Ki | 2300000±n/a nM |
---|
Citation | Wright, PA; Rostom, AA; Robinson, CV; Schofield, CJ Mass spectrometry reveals elastase inhibitors from the reactive centre loop of alpha1-antitrypsin. Bioorg Med Chem Lett10:1219-21 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50089096 |
---|
n/a |
---|
Name | BDBM50089096 |
Synonyms: | CHEMBL278549 | Met-Phe-Leu-Glu-Ala-Ile-Pro-Met | ent-Met-Phe-Leu-Glu-Ala-Ile-Pro-Met |
Type | Small organic molecule |
Emp. Form. | C44H70N8O11S2 |
Mol. Mass. | 951.204 |
SMILES | CC[C@@H](C)[C@@H](NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](Cc1ccccc1)NC(=O)[C@H](N)CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(O)=O |
Structure |
|