Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 11
LigandBDBM50091935
Substrate/Competitorn/a
Meas. Tech.ChEBML_124662
IC50 52±n/a nM
Citation Dumas JHatoum-Mokdad HSibley RRiedl BScott WJMonahan MKLowinger TBBrennan CNatero RTurner TJohnson JSSchoenleber RBhargava AWilhelm SMHousley TJRanges GEShrikhande A 1-Phenyl-5-pyrazolyl ureas: potent and selective p38 kinase inhibitors. Bioorg Med Chem Lett 10:2051-4 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 11
Name:Mitogen-activated protein kinase 11
Synonyms:MAP kinase p38 | Mitogen-activated protein kinase p38 beta | PRKM11 | SAPK2 | SAPK2B | Stress-activated protein kinase 2 | p38-2 | p38-beta | p38b
Type:Enzyme Catalytic Domain
Mol. Mass.:41351.73
Organism:Homo sapiens (Human)
Description:gi_20128774
Residue:364
Sequence:
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091935
n/a
NameBDBM50091935
Synonyms:1-[2-(3-Amino-phenyl)-5-tert-butyl-2H-pyrazol-3-yl]-3-(2,3-dichloro-phenyl)-urea | CHEMBL64040
TypeSmall organic molecule
Emp. Form.C20H21Cl2N5O
Mol. Mass.418.32
SMILESCC(C)(C)c1cc(NC(=O)Nc2cccc(Cl)c2Cl)n(n1)-c1cccc(N)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: