| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptase beta-2 |
|---|
| Ligand | BDBM50093134 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_210829 |
|---|
| Ki | 15000±n/a nM |
|---|
| Citation |  Rice, KD; Gangloff, AR; Kuo, EY; Dener, JM; Wang, VR; Lum, R; Newcomb, WS; Havel, C; Putnam, D; Cregar, L; Wong, M; Warne, RL Dibasic inhibitors of human mast cell tryptase. Part 1: synthesis and optimization of a novel class of inhibitors. Bioorg Med Chem Lett10:2357-60 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tryptase beta-2 |
|---|
| Name: | Tryptase beta-2 |
|---|
| Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30518.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_210702 |
|---|
| Residue: | 275 |
|---|
| Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
|---|
| BDBM50093134 |
|---|
| n/a |
|---|
| Name | BDBM50093134 |
|---|
| Synonyms: | CHEMBL79655 | Derivative of piperazine-1-carboxylic acid 5-(piperazine-1-carbonyloxy)-cyclooctyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H49N9O6 |
|---|
| Mol. Mass. | 691.8203 |
|---|
| SMILES | [#7]\[#6](-[#7])=[#7]/c1ccc(-[#6]-[#7]-[#6](=O)-[#7]-2-[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-[#8]-[#6@@H]-2-[#6]-[#6]-[#6]-[#6@@H](-[#6]-[#6]-[#6]-2)-[#8]-[#6](=O)-[#7]-2-[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-[#7]-[#6]-c2ccccc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
