| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50516935 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1936077 (CHEMBL4481836) |
|---|
| IC50 | 25000±n/a nM |
|---|
| Citation |  Sharma, K; Tanwar, O; Deora, GS; Ali, S; Alam, MM; Zaman, MS; Krishna, VS; Sriram, D; Akhter, M Expansion of a novel lead targeting M. tuberculosis DHFR as antitubercular agents. Bioorg Med Chem27:1421-1429 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_MYCTU | dfrA | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17872.62 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_102873 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MTMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLP
GRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIG
LPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
|
|
|
|---|
| BDBM50516935 |
|---|
| n/a |
|---|
| Name | BDBM50516935 |
|---|
| Synonyms: | CHEMBL4526073 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23NO4 |
|---|
| Mol. Mass. | 365.4223 |
|---|
| SMILES | CC(=O)c1c(C)n(Cc2ccccc2)c2ccc(OCCCC(O)=O)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
