Reaction Details |
| Report a problem with these data |
Target | Methylated-DNA--protein-cysteine methyltransferase |
---|
Ligand | BDBM5475 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_28400 (CHEMBL636819) |
---|
IC50 | 5100±n/a nM |
---|
Citation | Griffin, RJ; Arris, CE; Bleasdale, C; Boyle, FT; Calvert, AH; Curtin, NJ; Dalby, C; Kanugula, S; Lembicz, NK; Newell, DR; Pegg, AE; Golding, BT Resistance-modifying agents. 8. Inhibition of O(6)-alkylguanine-DNA alkyltransferase by O(6)-alkenyl-, O(6)-cycloalkenyl-, and O(6)-(2-oxoalkyl)guanines and potentiation of temozolomide cytotoxicity in vitro by O(6)-(1-cyclopentenylmethyl)guanine. J Med Chem43:4071-83 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methylated-DNA--protein-cysteine methyltransferase |
---|
Name: | Methylated-DNA--protein-cysteine methyltransferase |
Synonyms: | 6-O-methylguanine-DNA methyltransferase | MGMT | MGMT_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 21651.27 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_144711 |
Residue: | 207 |
Sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
|
|
|
BDBM5475 |
---|
n/a |
---|
Name | BDBM5475 |
Synonyms: | 6-(prop-2-en-1-yloxy)-9H-purin-2-amine | CHEMBL325053 | O6-Substituted Guanine Deriv. 15 |
Type | Small organic molecule |
Emp. Form. | C8H9N5O |
Mol. Mass. | 191.19 |
SMILES | Nc1nc(OCC=C)c2[nH]cnc2n1 |
Structure |
|