| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nonstructural protein 3 |
|---|
| Ligand | BDBM50538477 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1972915 (CHEMBL4605733) |
|---|
| Ki | 2300±n/a nM |
|---|
| Citation |  Pach, S; Sarter, TM; Yousef, R; Schaller, D; Bergemann, S; Arkona, C; Rademann, J; Nitsche, C; Wolber, G Catching a Moving Target: Comparative Modeling of Flaviviral NS2B-NS3 Reveals Small Molecule Zika Protease Inhibitors. ACS Med Chem Lett11:514-520 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nonstructural protein 3 |
|---|
| Name: | Nonstructural protein 3 |
|---|
| Synonyms: | Genome polyprotein | NS3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 7653.58 |
|---|
| Organism: | Zika virus |
|---|
| Description: | ChEMBL_119671 |
|---|
| Residue: | 66 |
|---|
| Sequence: | AETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMK
RGDLPV
|
|
|
|---|
| BDBM50538477 |
|---|
| n/a |
|---|
| Name | BDBM50538477 |
|---|
| Synonyms: | CHEMBL4633138 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27N3O3 |
|---|
| Mol. Mass. | 321.4146 |
|---|
| SMILES | Cc1ccc(cc1OCCN)C(=O)NCC(O)CN1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
