| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50096445 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_80565 (CHEMBL694116) |
|---|
| IC50 | 10±n/a nM |
|---|
| Citation |  Mak, CC; Le, VD; Lin, YC; Elder, JH; Wong, CH Design, synthesis, and biological evaluation of HIV/FIV protease inhibitors incorporating a conformationally constrained macrocycle with a small P3' residue. Bioorg Med Chem Lett11:219-22 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50096445 |
|---|
| n/a |
|---|
| Name | BDBM50096445 |
|---|
| Synonyms: | (2R,3S)-3-{(S)-2-[(S)-2-Acetylamino-3-(1H-indol-3-yl)-propionylamino]-3-methyl-butyrylamino}-2-hydroxy-N-((8S,11S)-8-isopropyl-7,10-dioxo-2-oxa-6,9-diaza-bicyclo[11.2.2]heptadeca-1(16),13(17),14-trien-11-yl)-4-phenyl-butyramide | CHEMBL302958 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C45H57N7O8 |
|---|
| Mol. Mass. | 823.9762 |
|---|
| SMILES | CC(C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(C)=O)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)C(=O)N[C@H]1Cc2ccc(OCCCNC(=O)[C@@H](NC1=O)C(C)C)cc2 |
|---|
| Structure | 
|
|---|
Search and Browse
