| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50096717 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146992 |
|---|
| IC50 | >10±n/a nM |
|---|
| Citation |  Sasaki, Y; Hirabuki, M; Ambo, A; Ouchi, H; Yamamoto, Y Enkephalin analogues with 2',6'-dimethylphenylalanine replacing phenylalanine in position 4. Bioorg Med Chem Lett11:327-9 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50096717 |
|---|
| n/a |
|---|
| Name | BDBM50096717 |
|---|
| Synonyms: | (S)-2-[(S)-2-(2-{2-[(S)-2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-acetylamino}-acetylamino)-3-(2,6-dimethyl-phenyl)-propionylamino]-4-methyl-pentanoic acid | CHEMBL112708 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H41N5O7 |
|---|
| Mol. Mass. | 583.6758 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c(C)cccc1C)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
