| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase, mitochondrial |
|---|
| Ligand | BDBM50542140 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1985989 (CHEMBL4619395) |
|---|
| IC50 | 11±n/a nM |
|---|
| Citation |  Hu, L; Cai, X; Dong, S; Zhen, Y; Hu, J; Wang, S; Jiang, J; Huang, J; Han, Y; Qian, Y; Yuan, Y; Hu, W Synthesis and Anticancer Activity of Novel Actinonin Derivatives as HsPDF Inhibitors. J Med Chem63:6959-6978 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase, mitochondrial |
|---|
| Name: | Peptide deformylase, mitochondrial |
|---|
| Synonyms: | DEFM_HUMAN | PDF | PDF1A | Peptide deformylase mitochondrial | Peptide deformylase, mitochondrial | Polypeptide deformylase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27023.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_154318 |
|---|
| Residue: | 243 |
|---|
| Sequence: | MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
|
|
|
|---|
| BDBM50542140 |
|---|
| n/a |
|---|
| Name | BDBM50542140 |
|---|
| Synonyms: | CHEMBL4636076 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H27FN4O4 |
|---|
| Mol. Mass. | 406.4512 |
|---|
| SMILES | ONC(=O)C[C@@H](CC1CCCC1)C(=O)N1CCC[C@H]1C(=O)Nc1ccc(F)cn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
