| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nonstructural protein 3 |
|---|
| Ligand | BDBM26218 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1986298 (CHEMBL4619845) |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Voss, S; Nitsche, C Inhibitors of the Zika virus protease NS2B-NS3. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nonstructural protein 3 |
|---|
| Name: | Nonstructural protein 3 |
|---|
| Synonyms: | Genome polyprotein | NS3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 7653.58 |
|---|
| Organism: | Zika virus |
|---|
| Description: | ChEMBL_119671 |
|---|
| Residue: | 66 |
|---|
| Sequence: | AETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMK
RGDLPV
|
|
|
|---|
| BDBM26218 |
|---|
| n/a |
|---|
| Name | BDBM26218 |
|---|
| Synonyms: | (3S,6S,10aS)-N-(diphenylmethyl)-6-[(2S)-2-(methylamino)propanamido]-5-oxo-decahydropyrrolo[1,2-a]azocine-3-carboxamide | CHEMBL481422 | bicyclic Smac peptide mimetic, 20 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N4O3 |
|---|
| Mol. Mass. | 476.6104 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H]1CCCC[C@H]2CC[C@H](N2C1=O)C(=O)NC(c1ccccc1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
