Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50101853 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158325 (CHEMBL764951) |
---|
Ki | 5±n/a nM |
---|
Citation | Maruyama, T; Asada, M; Shiraishi, T; Sakata, K; Seki, A; Yoshida, H; Shinagawa, Y; Maruyama, T; Ohuchida, S; Nakai, H; Kondo, K; Toda, M Design and synthesis of a highly selective EP4-receptor agonist. Part 2: 5-thia and 9beta-haloPG derivatives with improved stability. Bioorg Med Chem Lett11:2033-5 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_MOUSE | PGE receptor, EP3 isoform alpha | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3 | Prostanoid EP3 receptor | Ptger3 | Ptgerep3 |
Type: | G-protein coupled receptor |
Mol. Mass.: | 40092.50 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 365 |
Sequence: | MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
|
|
|
BDBM50101853 |
---|
n/a |
---|
Name | BDBM50101853 |
Synonyms: | (11alpha,13E,15S)-11,15-dihydroxy-9-oxoprost-13-en-1-oic acid | (13E,15S)-11alpha,15-dihydroxy-9-oxoprost-13-en-1-oic acid | 11alpha,15alpha-dihydroxy-9-oxo-13-trans-prostenoic acid | ALPROSTADIL | CHEMBL495 | PGE-1 | PGE1 | prostaglandin E1 |
Type | Small organic molecule |
Emp. Form. | C20H34O5 |
Mol. Mass. | 354.481 |
SMILES | CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(O)=O |r| |
Structure |
|