Reaction Details |
| Report a problem with these data |
Target | Alpha-synuclein |
---|
Ligand | BDBM50545086 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1994333 (CHEMBL4628228) |
---|
Kd | 112±n/a nM |
---|
Citation | Chen, YF; Bian, J; Zhang, P; Bu, LL; Shen, Y; Yu, WB; Lu, XH; Lin, X; Ye, DY; Wang, J; Chu, Y Design, synthesis and identification of N, N-dibenzylcinnamamide (DBC) derivatives as novel ligands for ?-synuclein fibrils by SPR evaluation system. Bioorg Med Chem28:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Alpha-synuclein |
---|
Name: | Alpha-synuclein |
Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
Type: | Protein |
Mol. Mass.: | 14451.42 |
Organism: | Homo sapiens (Human) |
Description: | P37840 |
Residue: | 140 |
Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
BDBM50545086 |
---|
n/a |
---|
Name | BDBM50545086 |
Synonyms: | CHEMBL4648610 |
Type | Small organic molecule |
Emp. Form. | C23H20N2O4 |
Mol. Mass. | 388.4159 |
SMILES | COc1ccccc1N(Cc1ccccc1[N+]([O-])=O)C(=O)\C=C\c1ccccc1 |
Structure |
|