| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thromboxane A2 receptor |
|---|
| Ligand | BDBM50106547 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_207467 (CHEMBL816748) |
|---|
| IC50 | 510±n/a nM |
|---|
| Citation |  Soper, DL; Milbank, JB; Mieling, GE; Dirr, MJ; Kende, AS; Cooper, R; Jee, WS; Yao, W; Chen, JL; Bodman, M; Lundy, MW; De, B; Stella, ME; Ebetino, FH; Wang, Y; deLong, MA; Wos, JA Synthesis and biological evaluation of prostaglandin-F alkylphosphinic acid derivatives as bone anabolic agents for the treatment of osteoporosis. J Med Chem44:4157-69 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thromboxane A2 receptor |
|---|
| Name: | Thromboxane A2 receptor |
|---|
| Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
|---|
| Type: | Enyzme |
|---|
| Mol. Mass.: | 37445.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21731 |
|---|
| Residue: | 343 |
|---|
| Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
|---|
| BDBM50106547 |
|---|
| n/a |
|---|
| Name | BDBM50106547 |
|---|
| Synonyms: | 7-[3,5-Dihydroxy-2-(3-hydroxy-4-phenoxy-but-1-enyl)-cyclopentyl]-hept-5-enoic acid | CHEMBL334398 | PGF2Alpha,16-Phenoxy |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H30O6 |
|---|
| Mol. Mass. | 390.47 |
|---|
| SMILES | O[C@@H](COc1ccccc1)\C=C\[C@H]1[C@H](O)C[C@H](O)[C@@H]1C\C=C/CCCC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
