Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLDL-associated phospholipase A2
LigandBDBM50107480
Substrate/Competitorn/a
Meas. Tech.ChEBML_101009
IC50 0.200000±n/a nM
Citation Boyd HFFell SCHickey DMIfe RJLeach CAMacphee CHMilliner KJPinto ILRawlings DASmith SAStansfield IGStanway SJTheobald CJWhittaker CM Potent, orally active inhibitors of lipoprotein-associated phospholipase A(2): 1-(biphenylmethylamidoalkyl)-pyrimidones. Bioorg Med Chem Lett 12:51-5 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LDL-associated phospholipase A2
Name:LDL-associated phospholipase A2
Synonyms:1-alkyl-2-acetylglycerophosphocholine esterase | 2-acetyl-1-alkylglycerophosphocholine esterase | LDL-PLA(2) | PAF 2-acylhydrolase | PAF acetylhydrolase | Platelet-activating factor acetylhydrolase
Type:PROTEIN
Mol. Mass.:50084.41
Organism:Homo sapiens (Human)
Description:ChEMBL_156212
Residue:441
Sequence:
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50107480
n/a
NameBDBM50107480
Synonyms:CHEMBL348243 | N-(4'-Chloro-biphenyl-4-ylmethyl)-2-[2-(4-fluoro-benzylsulfanyl)-4-oxo-5-(2-piperazin-1-yl-pyrimidin-5-ylmethyl)-4H-pyrimidin-1-yl]-N-methyl-acetamide
TypeSmall organic molecule
Emp. Form.C36H35ClFN7O2S
Mol. Mass.684.225
SMILESCN(Cc1ccc(cc1)-c1ccc(Cl)cc1)C(=O)Cn1cc(Cc2cnc(nc2)N2CCNCC2)c(=O)nc1SCc1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: