| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50108346 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145273 |
|---|
| Ki | >600±n/a nM |
|---|
| Citation |  Yu, H; Prisinzano, T; Dersch, CM; Marcus, J; Rothman, RB; Jacobson, AE; Rice, KC Synthesis and biological activity of 8beta-substituted hydrocodone indole and hydromorphone indole derivatives. Bioorg Med Chem Lett12:165-8 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50108346 |
|---|
| n/a |
|---|
| Name | BDBM50108346 |
|---|
| Synonyms: | CHEMBL295295 | Indole Derivative |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24N2O2 |
|---|
| Mol. Mass. | 372.4596 |
|---|
| SMILES | C[C@@H]1C2C3Cc4ccc(O)c5O[C@@H](c6[nH]c7ccccc7c16)C2(CCN3C)c45 |TLB:10:27:2:25.23.24| |
|---|
| Structure | 
|
|---|
Search and Browse
