Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50113068 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_66266 |
---|
Ki | 7200±n/a nM |
---|
Citation | Choi, C; Li, JH; Vaal, M; Thomas, C; Limburg, D; Wu, YQ; Chen, Y; Soni, R; Scott, C; Ross, DT; Guo, H; Howorth, P; Valentine, H; Liang, S; Spicer, D; Fuller, M; Steiner, J; Hamilton, GS Use of parallel-synthesis combinatorial libraries for rapid identification of potent FKBP12 inhibitors. Bioorg Med Chem Lett12:1421-8 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50113068 |
---|
n/a |
---|
Name | BDBM50113068 |
Synonyms: | (S)-1-(Adamantan-1-ylthiocarbamoyl)-pyrrolidine-2-carboxylic acid 4-phenyl-butyl ester | CHEMBL31125 |
Type | Small organic molecule |
Emp. Form. | C26H36N2O2S |
Mol. Mass. | 440.641 |
SMILES | O=C(OCCCCc1ccccc1)[C@@H]1CCCN1C(=S)NC12C[C@H]3C[C@H](C[C@H](C3)C1)C2 |TLB:24:25:29:23.22.28,THB:24:23:29:25.30.26| |
Structure |
|