Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50113768 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_103857 (CHEMBL712975) |
---|
IC50 | 1650±n/a nM |
---|
Citation | Dios, A; Mitchell, RA; Aljabari, B; Lubetsky, J; O'Connor, K; Liao, H; Senter, PD; Manogue, KR; Lolis, E; Metz, C; Bucala, R; Callaway, DJ; Al-Abed, Y Inhibition of MIF bioactivity by rational design of pharmacological inhibitors of MIF tautomerase activity. J Med Chem45:2410-6 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
Type: | Enzyme |
Mol. Mass.: | 12478.18 |
Organism: | Homo sapiens (Human) |
Description: | P14174 |
Residue: | 115 |
Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
BDBM50113768 |
---|
n/a |
---|
Name | BDBM50113768 |
Synonyms: | (S)-methyl 2-(4-hydroxybenzylideneamino)-3-(1H-indol-3-yl)propanoate | 2-[(4-Hydroxy-benzylidene)-amino]-3-(1H-indol-3-yl)-propionic acid methyl ester | CHEMBL78684 |
Type | Small organic molecule |
Emp. Form. | C19H18N2O3 |
Mol. Mass. | 322.3578 |
SMILES | COC(=O)[C@H](Cc1c[nH]c2ccccc12)\N=C\c1ccc(O)cc1 |r| |
Structure |
|