| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50117264 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_223419 (CHEMBL844030) |
|---|
| IC50 | 730±n/a nM |
|---|
| Citation |  Rew, Y; Malkmus, S; Svensson, C; Yaksh, TL; Chung, NN; Schiller, PW; Cassel, JA; DeHaven, RN; Taulane, JP; Goodman, M Synthesis and biological activities of cyclic lanthionine enkephalin analogues: delta-opioid receptor selective ligands. J Med Chem45:3746-54 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50117264 |
|---|
| n/a |
|---|
| Name | BDBM50117264 |
|---|
| Synonyms: | 12-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-6-benzyl-13,13-dimethyl-5,8,11-trioxo-1-thia-4,7,10-triaza-cyclotridecane-3-carboxylic acid | CHEMBL122981 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H35N5O7S |
|---|
| Mol. Mass. | 585.672 |
|---|
| SMILES | CC1(C)SC[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)CNC(=O)[C@@H]1NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
