Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50118536 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_37198 (CHEMBL650799) |
---|
Ki | 7.2±n/a nM |
---|
Citation | Campiani, G; Ramunno, A; Fiorini, I; Nacci, V; Morelli, E; Novellino, E; Goegan, M; Mennini, T; Sullivan, S; Zisterer, DM; Williams, CD Synthesis of new molecular probes for investigation of steroid biosynthesis induced by selective interaction with peripheral type benzodiazepine receptors (PBR). J Med Chem45:4276-81 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50118536 |
---|
n/a |
---|
Name | BDBM50118536 |
Synonyms: | 4-Methyl-piperazine-1-carboxylic acid 5-phenyl-6-oxa-10b-aza-benzo[e]azulen-4-yl ester | CHEMBL135807 |
Type | Small organic molecule |
Emp. Form. | C24H23N3O3 |
Mol. Mass. | 401.4577 |
SMILES | CN1CCN(CC1)C(=O)OC1=C(Oc2ccccc2-n2cccc12)c1ccccc1 |t:11| |
Structure |
|