| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Ligand | BDBM50118774 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_207125 (CHEMBL805109) |
|---|
| pH | 7±n/a |
|---|
| Ki | 24000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Andersen, HS; Olsen, OH; Iversen, LF; Sørensen, AL; Mortensen, SB; Christensen, MS; Branner, S; Hansen, TK; Lau, JF; Jeppesen, L; Moran, EJ; Su, J; Bakir, F; Judge, L; Shahbaz, M; Collins, T; Vo, T; Newman, MJ; Ripka, WC; Møller, NP Discovery and SAR of a novel selective and orally bioavailable nonpeptide classical competitive inhibitor class of protein-tyrosine phosphatase 1B. J Med Chem45:4443-59 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 2 |
|---|
| Synonyms: | PTN2_HUMAN | PTPN2 | PTPT | T-cell protein tyrosine phosphatase (TCPTP) | T-cell protein-tyrosine phosphatase | TC-PTP | TCPTP | Tyrosine-protein phosphatase non-receptor type 2 | Tyrosine-protein phosphatase non-receptor type 2 (TC-PTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 48481.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P17706 |
|---|
| Residue: | 415 |
|---|
| Sequence: | MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
|
|
|
|---|
| BDBM50118774 |
|---|
| n/a |
|---|
| Name | BDBM50118774 |
|---|
| Synonyms: | 6-Benzyl-2-(oxalyl-amino)-4,5,6,7-tetrahydro-thieno[2,3-c]pyridine-3-carboxylic acid | 6-benzyl-2-(carboxyformamido)-4,5,6,7-tetrahydrothieno[2,3-c]pyridine-3-carboxylic acid | CHEMBL138951 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H16N2O5S |
|---|
| Mol. Mass. | 360.384 |
|---|
| SMILES | OC(=O)C(=O)Nc1sc2CN(Cc3ccccc3)CCc2c1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
