Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50120225 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_212345 |
---|
IC50 | 0.008000±n/a nM |
---|
Citation | Iwanowicz, EJ; Kimball, SD; Lin, J; Lau, W; Han, WC; Wang, TC; Roberts, DG; Schumacher, WA; Ogletree, ML; Seiler, SM Retro-binding thrombin active site inhibitors: identification of an orally active inhibitor of thrombin catalytic activity. Bioorg Med Chem Lett12:3183-6 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM50120225 |
---|
n/a |
---|
Name | BDBM50120225 |
Synonyms: | 2-{[2-(4-Guanidino-butyrylamino)-3-(4-nitro-phenyl)-propionyl]-methyl-amino}-3-hydroxy-N-(1-phenyl-ethyl)-butyramide | CHEMBL105819 |
Type | Small organic molecule |
Emp. Form. | C27H37N7O6 |
Mol. Mass. | 555.626 |
SMILES | CC(O)C(N(C)C(=O)C(Cc1ccc(cc1)[N+]([O-])=O)NC(=O)CCC[N-]C(N)=[NH2+])C(=O)NC(C)c1ccccc1 |
Structure |
|