Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin L
LigandBDBM50121039
Substrate/Competitorn/a
Meas. Tech.ChEBML_48518
IC50 0.700000±n/a nM
Citation Zhou NEKaleta JPurisima EMenard RMicetich RGSingh R 6-Acylamino-penam derivatives: synthesis and inhibition of cathepsins B, L, K, and S. Bioorg Med Chem Lett 12:3417-9 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cathepsin L
Name:Cathepsin L
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:37662.10
Organism:Rattus norvegicus
Description:ChEMBL_48517
Residue:334
Sequence:
MTPLLLLAVLCLGTALATPKFDQTFNAQWHQWKSTHRRLYGTNEEEWRRAVWEKNMRMIQ
LHNGEYSNGKHGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLMLQIPKTVDW
REKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHDQGNQGCNG
GLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEYAVANDTGFVDIPQQEKALMKAVA
TVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYGYEGTDSNKDKYWLVKN
SWGKEWGMDGYIKIAKDRNNHCGLATAASYPIVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121039
n/a
NameBDBM50121039
Synonyms:CHEMBL114410 | [(S)-2-Cyclohexyl-1-((5S,6R)-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]hept-6-ylcarbamoyl)-ethyl]-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C22H29N3O6S
Mol. Mass.463.547
SMILESO=C(N[C@@H](CC1CCCCC1)C(=O)N[C@H]1[C@H]2N(CCS2(=O)=O)C1=O)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: