| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM50559296 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2068631 (CHEMBL4723884) |
|---|
| Ki | <3.0±n/a nM |
|---|
| Citation |  Han, W; Ding, Y; Chen, Z; Langowski, JL; Bellamacina, C; Rico, A; Nishiguchi, GA; Lan, J; Atallah, G; Lindvall, M; Lin, S; Zang, R; Feucht, P; Zavorotinskaya, T; Dai, Y; Garcia, P; Burger, MT Synthesis and Structure-Activity Relationship of Tetra-Substituted Cyclohexyl Diol Inhibitors of Proviral Insertion of Moloney Virus (PIM) Kinases. J Med Chem63:14885-14904 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM50559296 |
|---|
| n/a |
|---|
| Name | BDBM50559296 |
|---|
| Synonyms: | CHEMBL4781892 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24F3N5O3 |
|---|
| Mol. Mass. | 487.4743 |
|---|
| SMILES | C[C@H]1C[C@H](C[C@@H](O)[C@@]1(O)CF)c1ccncc1NC(=O)c1nc(ncc1N)-c1c(F)cccc1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
