| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Succinate receptor 1 |
|---|
| Ligand | BDBM50561203 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2074424 (CHEMBL4729958) |
|---|
| IC50 | 92±n/a nM |
|---|
| Citation |  Velcicky, J; Wilcken, R; Cotesta, S; Janser, P; Schlapbach, A; Wagner, T; Piechon, P; Villard, F; Bouhelal, R; Piller, F; Harlfinger, S; Stringer, R; Fehlmann, D; Kaupmann, K; Littlewood-Evans, A; Haffke, M; Gommermann, N Discovery and Optimization of Novel SUCNR1 Inhibitors: Design of Zwitterionic Derivatives with a Salt Bridge for the Improvement of Oral Exposure. J Med Chem63:9856-9875 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Succinate receptor 1 |
|---|
| Name: | Succinate receptor 1 |
|---|
| Synonyms: | G-protein coupled receptor 91 | GPR91 | P2Y purinoceptor 1-like | SUCNR1 | SUCR1_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 38709.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_852820 |
|---|
| Residue: | 334 |
|---|
| Sequence: | MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNI
YLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDR
YLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGD
PNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVI
FSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGD
HFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
|
|
|
|---|
| BDBM50561203 |
|---|
| n/a |
|---|
| Name | BDBM50561203 |
|---|
| Synonyms: | CHEMBL4752851 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23ClF2N2O4 |
|---|
| Mol. Mass. | 500.922 |
|---|
| SMILES | OC(=O)Cc1cc(F)ccc1NC(=O)c1cccc(c1)-c1ccc(Cl)c(O[C@@H]2CCCNC2)c1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
