| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM50125750 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_105834 (CHEMBL716493) |
|---|
| IC50 | 3.1±n/a nM |
|---|
| Citation |  Herpin, TF; Yu, G; Carlson, KE; Morton, GC; Wu, X; Kang, L; Tuerdi, H; Khanna, A; Tokarski, JS; Lawrence, RM; Macor, JE Discovery of tyrosine-based potent and selective melanocortin-1 receptor small-molecule agonists with anti-inflammatory properties. J Med Chem46:1123-6 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34717.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01726 |
|---|
| Residue: | 317 |
|---|
| Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
|---|
| BDBM50125750 |
|---|
| n/a |
|---|
| Name | BDBM50125750 |
|---|
| Synonyms: | CHEMBL13910 | N-[1-[2-(4-Butyryl-4-phenyl-piperidin-1-yl)-1-(4-methoxy-benzyl)-2-oxo-ethylcarbamoyl]-2-(1H-imidazol-4-yl)-ethyl]-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H43N5O5 |
|---|
| Mol. Mass. | 649.7785 |
|---|
| SMILES | CCCC(=O)C1(CCN(CC1)C(=O)[C@@H](Cc1ccc(OC)cc1)NC(=O)[C@@H](Cc1cnc[nH]1)NC(=O)c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
