| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50126000 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146972 |
|---|
| IC50 | 2.8±n/a nM |
|---|
| Citation |  Ambo, A; Niizuma, H; Sasaki, A; Kohara, H; Sasaki, Y Dermorphin tetrapeptide analogues with 2',6'-dimethylphenylalanine (Dmp) substituted for aromatic amino acids have high mu opioid receptor binding and biological activities. Bioorg Med Chem Lett13:1269-72 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50126000 |
|---|
| n/a |
|---|
| Name | BDBM50126000 |
|---|
| Synonyms: | (R)-2-[(S)-2-Amino-3-(2,6-dimethyl-phenyl)-propionylamino]-5-guanidino-pentanoic acid [(S)-1-(2-carbamoyl-ethylcarbamoyl)-2-(2,6-dimethyl-phenyl)-ethyl]-amide | CHEMBL24059 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H46N8O4 |
|---|
| Mol. Mass. | 594.7481 |
|---|
| SMILES | Cc1cccc(C)c1C[C@H](N)C(=O)N[C@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c(C)cccc1C)C(=O)NCCC(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
