Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 11A (PDE11A)
LigandBDBM50126452
Substrate/Competitorn/a
Meas. Tech.ChEBML_156293
IC50 2±n/a nM
Citation Maw GNAllerton CMGbekor EMillion WA Design, synthesis and biological activity of beta-carboline-based type-5 phosphodiesterase inhibitors. Bioorg Med Chem Lett 13:1425-8 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 11A (PDE11A)
Name:Phosphodiesterase 11A
Synonyms:Dual 3'''''''''''''''',5''''''''''''''''-cyclic-AMP and -GMP phosphodiesterase 11A | Phosphodiesterase 11 | Phosphodiesterase 11A | Phosphodiesterase 11A (PDE11A4) | Phosphodiesterase 11A4 | cAMP and cGMP phosphodiesterase 11A
Type:Enzyme
Mol. Mass.:104751.53
Organism:Homo sapiens (Human)
Description:Q9HCR9
Residue:933
Sequence:
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50126452
n/a
NameBDBM50126452
Synonyms:(6R,12aR)-6-Benzo[1,3]dioxol-5-yl-2-[(R)-1-(2-pyridin-2-yl-ethyl)-pyrrolidin-3-yl]-2,3,6,7,12,12a-hexahydro-pyrazino[1',2':1,6]pyrido[3,4-b]indole-1,4-dione | CHEMBL284070
TypeSmall organic molecule
Emp. Form.C32H31N5O4
Mol. Mass.549.6196
SMILESO=C1CN([C@@H]2CCN(CCc3ccccn3)C2)C(=O)[C@H]2Cc3c([nH]c4ccccc34)[C@H](N12)c1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: