| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50060464 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157790 (CHEMBL878773) |
|---|
| IC50 | 450±n/a nM |
|---|
| Citation |  Mitsumori, S; Tsuri, T; Honma, T; Hiramatsu, Y; Okada, T; Hashizume, H; Inagaki, M; Arimura, A; Yasui, K; Asanuma, F; Kishino, J; Ohtani, M Synthesis and biological activity of various derivatives of a novel class of potent, selective, and orally active prostaglandin D2 receptor antagonists. 1. Bicyclo[2.2.1]heptane derivatives. J Med Chem46:2436-45 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50060464 |
|---|
| n/a |
|---|
| Name | BDBM50060464 |
|---|
| Synonyms: | (+) 7-[3-(Biphenyl-4-sulfonylamino)-bicyclo[2.2.1]hept-2-yl]-hept-5-enoic acid | (Z)-7-[(1S,2R,3R,4R)-3-(Biphenyl-4-sulfonylamino)-bicyclo[2.2.1]hept-2-yl]-hept-5-enoic acid | CHEMBL79511 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H31NO4S |
|---|
| Mol. Mass. | 453.594 |
|---|
| SMILES | OC(=O)CCC\C=C/C[C@@H]1[C@H]2CC[C@H](C2)[C@H]1NS(=O)(=O)c1ccc(cc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
